Welcome to GinQK Boost
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Ginger Lemon Shots 2 - 8 oz bottles

Ginger Lemon Shots 2 - 8 oz bottles

Product Code: UmqUpU5
Product Condition: New
$25.92 inc. tax
$24.00 ex. tax
? Tax based on California, United States.
 Add to Cart
Description
Benefits: Immune system boost, balance body PH, aids digestion, filters toxins from the body, rich in potassium, rich in vitamin C and flavonoids


Ingredients: Ginger, Organic Lemons. Filtered Water, Organic Stevia
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
write review
Huge Boost
Monday, May 4, 2020
Once I stated taking the shots I noticed a boost along with a healthier feeling when traveling into work. Taking the boost actually helped me stay away from my morning energy drinks and I definitely think it has helped boost my immune system which was necessary during these flu/covid times. Good stuff!
Bobby D.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i